Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIR SIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTISAKD TLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATL RISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPK RKAAYDSNGNVAVAFLYYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISS VISVSMSSNPPTLYELEKITFTLSHRKVTDRYRSLCAFWNYSPDTMNGSW SSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIGIKDYNILTRITQLG IIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVGINTN TNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFY IFGYLSPAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILV NLLAFGVIIYKVFRHTAGLKPEVSCFENIRSCARGALALLFLLGTTWIFG VLHVVHASVVTAYLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLFKNVPC CFGCLR
    • Amino acids
      1 to 606
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADGRL4
    • Adhesion G protein-coupled receptor L4
    • EGF
    • EGF latrophilin and seven transmembrane domain containing 1
    • EGF TM7 latrophilin related protein
    • EGF, latrophilin and seven transmembrane domain-containing protein 1
    • EGF, latrophilin, and 7 transmembrane domain-containing protein 1
    • EGF-, TM7-, and latrophilin-related protein
    • EGF-TM7-latrophilin-related protein
    • EGFTM7 latrophilin related protein
    • ELTD 1
    • ELTD1
    • ELTD1_HUMAN
    • ETL
    • ETL protein
    • KPG_003
    • latrophilin and seven transmembrane domain-containing protein 1
    • UNQ202/PRO228
    • zgc:63629
    see all
  • Function
    Could be involved in cardiac development.
  • Tissue specificity
    Mainly expressed in smooth muscle.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 2 EGF-like domains.
    Contains 1 GPS domain.
  • Developmental stage
    Up-regulated in the adult heart.
  • Domain
    The transmembrane domain is not required for cleavage, but it is required for dimer formation.
  • Post-translational
    modifications
    Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab163786 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up