Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAVPPSAPQPRASFHLRRHTPCPQCSW GMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQELRPH WKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTELLVDRENE VRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIAL EMAKIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLER ELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQ AFDIGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQKGMAVTPREVQ RLYVQVNKFALASHFFWALWALIQNQYSTIDFDFLRYAVIRFNQYFKVKP QASALEMPK
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 386
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_060678.

Specifications

Our Abpromise guarantee covers the use of ab202617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab202617 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • 4933417N20Rik
    • AI197444
    • EC 2.7.1.82
    • EKI 2
    • EKI2
    • EKI2_HUMAN
    • Ethanolamine kinase 2
    • Ethanolamine kinase like protein
    • Ethanolamine kinase-like protein
    • ETNK 2
    • ETNK2
    • FLJ10761
    • HMFT1716
    • RP11 74C13.2
    • Tuc1
    see all
  • Function
    Highly specific for ethanolamine phosphorylation. Does not have choline kinase activity.
  • Tissue specificity
    Expressed in kidney, liver, ovary, testis and prostate.
  • Pathway
    Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 1/3.
  • Sequence similarities
    Belongs to the choline/ethanolamine kinase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202617 (3 µg).

References

ab202617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up