Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14921
    • SpeciesHuman
    • SequenceMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALK ATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCM NGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYP ESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLK YENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQD SFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSC QSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKN IIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
    • Molecular weight75 kDa including tags
    • Amino acids1 to 441

Specifications

Our Abpromise guarantee covers the use of ab114322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Avian erythroblastosis virus E26 (v ets) oncogene homolog 1
    • C ets 1 protein
    • ETS 1
    • Ets protein
    • ETS1
    • ETS1 protein
    • ETS1_HUMAN
    • EWSR 2
    • EWSR2
    • FLJ10768
    • P54
    • Protein C-ets-1
    • v ets avian erythroblastosis virus E2 oncogene homolog
    • v ets avian erythroblastosis virus E26 oncogene homolog 1
    • v ets erythroblastosis virus E26 oncogene homolog 1
    • v-ets erythroblastosis virus E26 oncogene homolog 1
    see all
  • FunctionTranscription factor.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Post-translational
    modifications
    Sumoylated on Lys-15 and Lys-227, preferentially by SUMO2; which inhibits transcriptional activity.
    Ubiquitinated; which induces proteasomal degradation.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human ETS1 protein images

  • SDS-PAGE analysis of ab114322 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human ETS1 protein (ab114322)

ab114322 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"