Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEF RHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNK RILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN
    • Amino acids
      1 to 143
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI414410
    • bA110J1.4
    • ETS domain transcriptional repressor PE1
    • ETS family transcriptional repressor
    • ETS translocation variant 3
    • ets variant 3
    • ets variant gene 3
    • ets variant gene 3, ETS family transcriptional repressor
    • ETV3
    • ETV3_HUMAN
    • ME PE1
    • METS
    • Mitogenic Ets transcriptional suppressor
    • Oncogene PE1
    • PE 1
    • PE-1
    • PE1
    see all
  • Function
    Transcriptional repressor that contribute to growth arrest during terminal macrophage differentiation by repressing target genes involved in Ras-dependent proliferation. Represses MMP1 promoter activity.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158389 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up