Overview

  • Product name
    Recombinant Human EVI2B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSIS PAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAV
    • Amino acids
      23 to 121
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD361
    • D17S376
    • Ecotropic viral integration site 2B
    • Ecotropic viral integration site 2B protein homolog
    • EVDB
    • EVI 2B
    • EVI-2B
    • Evi2b
    • EVI2B protein
    • EVI2B_HUMAN
    • Protein EVI2B
    see all
  • Tissue specificity
    Bone marrow, peripheral blood mononuclear cells, fibroblasts and Epstein-Barr virus-transformed lymphoblastoid cell lines.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158394 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up