Recombinant Human Exonuclease 1 protein (ab152957)

Overview

  • Product name
    Recombinant Human Exonuclease 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWK NFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ
    • Amino acids
      747 to 846
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • exo1
    • EXO1_HUMAN
    • ExoI
    • Exonuclease 1
    • Exonuclease I
    • Exonuclease1
    • HEX1
    • hExo I
    • hExo1
    • hExoI
    • Rad2 nuclease family member homolog of S. cerevisiae exonuclease 1
    see all
  • Function
    5'->3' double-stranded DNA exonuclease which may also possess a cryptic 3'->5' double-stranded DNA exonuclease activity. Functions in DNA mismatch repair (MMR) to excise mismatch-containing DNA tracts directed by strand breaks located either 5' or 3' to the mismatch. Also exhibits endonuclease activity against 5'-overhanging flap structures similar to those generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Required for somatic hypermutation (SHM) and class switch recombination (CSR) of immunoglobulin genes. Essential for male and female meiosis.
  • Tissue specificity
    Highly expressed in bone marrow, testis and thymus. Expressed at lower levels in colon, lymph nodes, ovary, placenta, prostate, small intestine, spleen and stomach.
  • Sequence similarities
    Belongs to the XPG/RAD2 endonuclease family. EXO1 subfamily.
  • Developmental stage
    Highly expressed in fetal liver and at lower levels in fetal brain, heart, kidney, spleen and thymus.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage and in response to agents stalling DNA replication, probably by ATM or ATR. Phosphorylation at Ser-454, Thr-621 and Ser-714 is induced upon DNA-damage caused by treatment with hydroxyurea (HU) but not upon IR treatment. The HU-induced EXO1 triple phosphorylation facilitates destabilisation/degradation of the protein.
  • Cellular localization
    Nucleus. Colocalizes with PCNA to discrete nuclear foci in S-phase.
  • Information by UniProt

Images

  • ab152957 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up