Recombinant Human EXOSC10 protein (ab152620)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKAS GGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 99

Specifications

Our Abpromise guarantee covers the use of ab152620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Autoantigen PM/Scl 2
    • Exosc10
    • Exosome component 10
    • EXOSX_HUMAN
    • P100 polymyositis scleroderma overlap syndrome associated autoantigen
    • P100 polymyositis-scleroderma overlap syndrome-associated autoantigen
    • p2
    • p3
    • p4
    • PM Scl
    • PM/Scl 100
    • PM/Scl-100
    • PMSCL
    • PMSCL2
    • Polymyositis/scleroderma autoantigen 100 kDa
    • Polymyositis/scleroderma autoantigen 2
    • Polymyositis/scleroderma autoantigen 2 100 kDa
    • RRP6
    • Rrp6p
    see all
  • Function
    Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. EXOSC10 has 3'-5' exonuclease activity (By similarity). EXOSC10 is required for nucleolar localization of C1D and probably mediates the association of SKIV2L2, C1D and MPP6 wth the RNA exosome involved in the maturation of 5.8S rRNA.
  • Sequence similarities
    Contains 1 3'-5' exonuclease domain.
    Contains 1 HRDC domain.
  • Cellular localization
    Cytoplasm. Nucleus, nucleolus. Nucleus. Strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152620 stained with Coomassie Blue.

References

ab152620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up