Recombinant Human Exportin T protein (ab161383)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDD HVKFFCFQVLEHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQPEKTF IRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYLRILMAID SELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSE VTCQCLEVVGAYVSWIDLSLIANDRFINMLLGHMSIEVLREEACDCLFEV VNKGMDPVDKMKLVESLCQVLQSAGFFSIDQEEDVDFLARFSKLVNGMGQ SLIVSWSKLIKNGDIKNAQEALQAIETKVALMLQLLIHEDDDISSNIIGF CYDYLHILKQLTVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAM FVEYRKQLKLLLDRLAQVSPELLLASVRRVFSSTLQNWQTTRFMEVEVAI RLLYMLAEALPVSHGAHFSGDVSKASALQDMMRTLVTSGVSSYQHTSVTL EFFETVVRYEKFFTVEPQHIPCVLMAFLDHRGLRHSSAKVRSRTAYLFSR FVKSLNKQMNPFIEDILNRIQDLLELSPPENGHQSLLSSDDQLFIYETAG VLIVNSEYPAERKQALMRNLLTPLMEKFKILLEKLMLAQDEERQASLADC LNHAVGFASRTSKAFSNKQTVKQCGCSEVYLDCLQTFLPALSCPLQKDIL RSGVRTFLHRMIICLEEEVLPFIPSASEHMLKDCEAKDLQEFIPLINQIT AKFKIQVSPFLQQMFMPLLHAIFEVLLRPAEENDQSAALEKQMLRRSYFA FLQTVTGSGMSEVIANQGAENVERVLVTVIQGAVEYPDPIAQKTCFIILS KLVELWGGKDGPVGFADFVYKHIVPACFLAPLKQTFDLADAQTVLALSEC AVTLKTIHLKRGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAKVFK NYLKVFFQRAKP
    • Amino acids
      1 to 962
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110004L07Rik
    • 3110065H13Rik
    • AI452076
    • C79645
    • Exportin tRNA
    • Exportin(tRNA)
    • Nuclear export receptor for tRNAs
    • tRNA exportin
    • XPO3
    • XPOT
    see all
  • Relevance
    This gene encodes a protein belonging to the RAN GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP bound RAN.
  • Cellular localization
    Nuclear; once bound to tRNA and Ran the complex translocates to the cytoplasm. Shuttles between the nucleus and the cytoplasm.

Images

  • ab161383 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up