Overview

  • Product name
    Recombinant Human EYS protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRK VNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT
    • Amino acids
      309 to 407
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA166P24.2
    • bA307F22.3
    • bA74E24.1
    • C6orf178
    • C6orf179
    • C6orf180
    • dJ1018A4.2
    • dJ22I17.2
    • dJ303F19.1
    • EGF-like protein 10
    • EGF-like protein 11
    • EGF-like-domain, multiple 10
    • EGF-like-domain, multiple 11
    • EGFL10
    • EGFL11
    • Epidermal growth factor-like protein 10
    • Epidermal growth factor-like protein 11
    • Eyes shut homolog (Drosophila)
    • EYS
    • EYS_HUMAN
    • KIAA0663
    • OTTHUMP00000016688
    • OTTHUMP00000179129
    • OTTHUMP00000213100
    • OTTHUMP00000217891
    • Protein eyes shut homolog
    • Protein spacemaker homolog
    • RP25
    • SPAM
    see all
  • Function
    Required to maintain the integrity of photoreceptor cells.
  • Tissue specificity
    Present in retina.
  • Involvement in disease
    Defects in EYS are the cause of retinitis pigmentosa type 25 (RP25) [MIM:602772]. RP leads to degeneration of retinal photoreceptor cells. Patients suffer from night blindness, beginning at approximately 25 years of age, and deterioration of visual acuity (central vision), beginning at approximately 30 years of age. By age 55 to 60 years, many affected subjects have no perception of light in either eye.
  • Sequence similarities
    Belongs to the EYS family.
    Contains 27 EGF-like domains.
    Contains 5 laminin G-like domains.
  • Cellular localization
    Secreted. Localizes in the photoreceptor cell layer.
  • Information by UniProt

Images

  • ab166318 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up