Recombinant human EZH2 + EED + SUZ12 + AEBP2 + RBBP4 (mutated A677 G) protein (ab198114)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Human
    • Molecular weight
      86 kDa including tags
    • Amino acids
      2 to 751
    • Modifications
      mutated A677 G
    • Tags
      His tag N-Terminus
    • Additional sequence information
      GenBank Accession No. NM_004456
    Amino Acid Sequence 2
    • Accession
    • Species
      Human
    • Sequence
      SEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTE RPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQF NWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCA WTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPR DPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKI MSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFST RDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVT ILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKC TTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR
    • Molecular weight
      51 kDa including tags
    • Amino acids
      2 to 441
    • Tags
      DDDDK tag N-Terminus
    • Additional sequence information
      EED, GenBank Accession No. NM_003797
    Amino Acid Sequence 3
    • Accession
    • Species
      Human
    • Sequence
      APQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGS YSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLR TRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESH SLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSC PIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLL FRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTV FDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQ GPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIA VKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCP WCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAG NPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEV EQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIE EFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKN LCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEI TEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
    • Molecular weight
      87 kDa including tags
    • Amino acids
      2 to 739
    • Tags
      His tag N-Terminus
    • Additional sequence information
      SUZ12, GenBank Accession No. NM_015355
    Amino Acid Sequence 4
    • Accession
    • Species
      Human
    • Sequence
      AAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEA EAVAALLLNGGSGGGGGGGGGGVGGGEAETMSEPSPESASQAGEDEDEEE DDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSLSPGAASSSSGD GDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSG GRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGS TTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKG CKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPT HFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQ TLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHW MPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRL KRTLIRKVFNLYLSKQ
    • Molecular weight
      53 kDa including tags
    • Amino acids
      2 to 517
    • Tags
      His tag N-Terminus
    • Additional sequence information
      AEBP2, GenBank Accession No. NM_153207
    Amino Acid Sequence 5
    • Accession
    • Species
      Human
    • Sequence
      ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLP DVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSE KGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLV FDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT ICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQK LMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALW DLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIG EEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQV WQMAENIYNDEDPEGSVDPEGQGS
    • Molecular weight
      48 kDa including tags
    • Amino acids
      2 to 425
    • Tags
      His tag N-Terminus
    • Additional sequence information
      RBBP4, GenBank Accession No. NM_005610

Specifications

Our Abpromise guarantee covers the use of ab198114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ab198114 is useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 82 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 0.14% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Adipocyte enhancer-binding protein 2
    • AE-binding protein 2
    • CAF-1 subunit C
    • CAF-I 48 kDa subunit
    • CAF-I p48
    • ChET 9 protein
    • CHET9
    • Chromatin assembly factor 1 subunit C
    • Chromatin assembly factor I p48 subunit
    • Chromatin precipitated E2F target 9 protein
    • EC=2.1.1.43
    • embryonic ectoderm development
    • Enhancer of zeste homolog 2
    • ENX-1
    • ENX1
    • EZH1
    • hEED
    • Histone-binding protein RBBP4
    • Histone-lysine N-methyltransferase EZH2
    • JJAZ1
    • Joined to JAZF1 protein
    • KIAA0160
    • KMT6
    • KMT6A
    • Lysine N-methyltransferase 6
    • MSI1 protein homolog
    • Nucleosome-remodeling factor subunit RBAP48
    • Polycomb protein EED
    • Polycomb protein SUZ12
    • RBAP48
    • Retinoblastoma-binding protein 4
    • Retinoblastoma-binding protein p48
    • Suppressor of zeste 12 protein homolog
    • WAIT-1
    • WD protein associating with integrin cytoplasmic tails 1
    • WVS2
    • Zinc finger protein AEBP2
    see all
  • Relevance
    EED: Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A. RBBP4: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex. SUZ12: Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A. EZH2: Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Compared to EZH2-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1, CDKN2A and retinoic acid target genes. EZH2 can also methylate non-histone proteins such as the transcription factor GATA4. AEBP2: DNA-binding transcriptional repressor. May interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3.
  • Cellular localization
    Chromosome Nucleus

Images

  • 4-20% SDS-PAGE analysis of ab198114.

    Lane 1: 3.16 µg ab198114 enzyme complex
    Lane 2: Protein marker

    Stained with Coomassie blue.

References

ab198114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up