Overview

  • Product name
    Recombinant Human FAAH1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGD IWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      480 to 579

Specifications

Our Abpromise guarantee covers the use of ab114426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anandamide amidohydrolase
    • Anandamide amidohydrolase 1
    • FA2H
    • FAAH
    • FAAH-1
    • FAAH1_HUMAN
    • Fatty acid 2-hydroxylase
    • Fatty acid alpha-hydroxylase
    • Fatty acid amide hydrolase
    • Fatty-acid amide hydrolase 1
    • MGC102823
    • MGC138146
    • Oleamide hydrolase
    • Oleamide hydrolase 1
    see all
  • Function
    Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
  • Tissue specificity
    Highly expressed in the brain, small intestine, pancreas, skeletal muscle and testis. Also expressed in the kidney, liver, lung, placenta and prostate.
  • Sequence similarities
    Belongs to the amidase family.
  • Cellular localization
    Endomembrane system. Cytoplasm > cytoskeleton. Seems to be attached to intracellular membranes and a portion of the cytoskeletal network.
  • Information by UniProt

Recombinant Human FAAH1 protein images

  • ab114426 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human FAAH1 protein (ab114426)

ab114426 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up