Recombinant Human FAAH2 protein (denatured) (ab174403)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSGGPKFASKTPRPVTEPLLLLSGMQLAK LIRQRKVKCIDVVQAYINRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLA EKQEDEATLENKWPFLGVPLTVKEAFQLQGMPNSSGLMNRRDAIAKTDAT VVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQHIVGGSSG GEGCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPL AVGAQELFLCTGPMCRYAEDLAPMLKVMAGPGIKRLKLDTKVHLKDLKFY WMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKLKKMKYSFQ LWIAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPS IGLALLEEKLRYSNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVA PKHHVPLTRPFNFAYTGVFSALGLPVTQCPLGLNAKGLPLGIQVVAGPFN DHLTLAVAQYLEKTFGGWVCPGKF
    • Molecular weight
      57 kDa including tags
    • Amino acids
      32 to 532
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NCBI Accession No. NP_777572).

Specifications

Our Abpromise guarantee covers the use of ab174403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • AMDD
    • amidase domain containing
    • amidase domain containing protein
    • Amidase domain-containing protein
    • Anandamide amidohydrolase 2
    • FAAH-2
    • FAAH2
    • FAAH2_HUMAN
    • fatty acid amide hydrolase 2
    • Fatty-acid amide hydrolase 2
    • FLJ31204
    • Oleamide hydrolase 2
    • RP11-479E16
    • RP11-479E16.1
    see all
  • Function
    Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes monounsaturated substrate anandamide preferentially as compared to polyunsaturated substrates.
  • Tissue specificity
    Highly expressed in the brain, small intestine and testis. Also expressed in the heart, kidney, liver, lung and prostate.
  • Sequence similarities
    Belongs to the amidase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3μg ab174403.

References

ab174403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up