Overview

  • Product name
    Recombinant Human FABP9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMVEPFLGTWKLVSSENFEDYMKELGV NFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEEFDETTA DNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKMNNIVST RIYEKV
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 132
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • 15 kDa perforatorial protein
    • Fabp9
    • FABP9_HUMAN
    • Fatty acid binding protein 9, testis
    • Fatty acid-binding protein 9
    • PERF
    • PERF15
    • T-FABP
    • Testis lipid-binding protein
    • Testis-type fatty acid-binding protein
    • TLBP
    see all
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human FABP9 protein images

  • 15% SDS-PAGE (3 µg loaded)

References for Recombinant Human FABP9 protein (ab124550)

ab124550 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up