Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKV RLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK
    • Molecular weight
      36 kDa including tags
    • Amino acids
      622 to 711

Specifications

Our Abpromise guarantee covers the use of ab152376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACS 4
    • ACS4
    • ACSL 4
    • Acsl4
    • ACSL4_HUMAN
    • acyl CoA synthetase 4
    • Acyl CoA synthetase long chain family member 4
    • FACL 4
    • FACL4
    • Fatty acid Coenzyme A ligase
    • fatty acid Coenzyme A ligase long-chain 4
    • LACS 4
    • LACS4
    • Lignoceroyl CoA synthase
    • Long chain 4
    • long chain acyl CoA synthetase 4
    • long chain fatty acid CoA ligase 4
    • long chain fatty acid Coenzyme A ligase 4
    • Long-chain acyl-CoA synthetase 4
    • Long-chain-fatty-acid--CoA ligase 4
    • MRX63
    • MRX68
    see all
  • Function
    Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses arachidonate and eicosapentaenoate as substrates.
  • Involvement in disease
    Defects in ACSL4 are the cause of mental retardation X-linked type 63 (MRX63) [MIM:300387]. Mental retardation is a mental disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
    Defects in ACSL4 are involved in Alport syndrome with mental retardation midface hypoplasia and elliptocytosis (ATS-MR) [MIM:300194]. A X-linked contiguous gene deletion syndrome characterized by glomerulonephritis, deafness, mental retardation, midface hypoplasia and elliptocytosis.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Mitochondrion outer membrane. Peroxisome membrane. Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152376 stained with Coomassie Blue.

References

ab152376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up