Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60427
    • SpeciesHuman
    • SequenceMAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTR RHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS
    • Molecular weight37 kDa including tags
    • Amino acids1 to 99

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D5D
    • Delta 5 desaturase
    • Delta 5 fatty acid desaturase
    • Delta(5) desaturase
    • Delta(5) fatty acid desaturase
    • Delta-5 desaturase
    • Fads1
    • FADS1_HUMAN
    • FADS6
    • FADSD5
    • Fatty acid desaturase 1
    • FLJ38956
    • Linoleoyl CoA desaturase (delta 6 desaturase) like 1
    • LLCDL1
    • TU12
    see all
  • FunctionComponent of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) and eicosatetraenoic acid (20:4n-3) to generate arachidonic acid (AA) (20:4n-6) and eicosapentaenoic acid (EPA)(20:5n-3) respectively.
  • Tissue specificityExpressed in many tissues, it is most abundant in the liver, brain, adrenal gland and heart. Found as well in skeletal muscle, lung, placenta, kidney, pancreas and retina.
  • PathwayLipid metabolism; polyunsaturated fatty acid biosynthesis.
  • Sequence similaritiesBelongs to the fatty acid desaturase family.
    Contains 1 cytochrome b5 heme-binding domain.
  • Developmental stageHighly expressed in fetal liver and fetal brain.
  • DomainThe histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human FADS1 protein images

  • ab114797 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human FADS1 protein (ab114797)

ab114797 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"