Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y5Q0
    • SpeciesHuman
    • SequencePGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHH GAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
    • Molecular weight36 kDa including tags
    • Amino acids16 to 113

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYB5RP
    • Cytochrome b5 related protein
    • Cytochrome b5-related protein
    • Delta 9 desaturase
    • Delta 9 fatty acid desaturase
    • FADS 3
    • FADS3
    • FADS3_HUMAN
    • Fatty acid desaturase 3
    • Linoleoyl CoA desaturase (delta 9 desaturase) like 3
    • Linoleoyl CoA desaturase like 3
    • LLCDL 3
    • LLCDL3
    • OTTHUMP00000236055
    • OTTHUMP00000236056
    • OTTHUMP00000236059
    see all
  • Tissue specificityHas been found in heart, liver, lung, uterus, and brainstem.
  • Sequence similaritiesBelongs to the fatty acid desaturase family.
    Contains 1 cytochrome b5 heme-binding domain.
  • DomainThe histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human FADS3 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116864 at approximately 36.41 kDa.

References for Recombinant Human FADS3 protein (ab116864)

ab116864 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"