Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHH GAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
    • Molecular weight
      36 kDa including tags
    • Amino acids
      16 to 113

Specifications

Our Abpromise guarantee covers the use of ab116864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYB5RP
    • Cytochrome b5 related protein
    • Cytochrome b5-related protein
    • Delta 9 desaturase
    • Delta 9 fatty acid desaturase
    • FADS 3
    • FADS3
    • FADS3_HUMAN
    • Fatty acid desaturase 3
    • Linoleoyl CoA desaturase (delta 9 desaturase) like 3
    • Linoleoyl CoA desaturase like 3
    • LLCDL 3
    • LLCDL3
    • OTTHUMP00000236055
    • OTTHUMP00000236056
    • OTTHUMP00000236059
    see all
  • Tissue specificity
    Has been found in heart, liver, lung, uterus, and brainstem.
  • Sequence similarities
    Belongs to the fatty acid desaturase family.
    Contains 1 cytochrome b5 heme-binding domain.
  • Domain
    The histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116864 at approximately 36.41 kDa.

References

ab116864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up