Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
    • Amino acids
      551 to 650
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGI 03
    • FAF1
    • FAF1 protein
    • FAF1_HUMAN
    • Fas (TNFRSF6) associated factor 1
    • FAS associated factor 1
    • Fas associated protein factor 1
    • FAS-associated factor 1
    • FLJ37524
    • hFAF1
    • HFAF1s
    • Protein FAF1
    • TNFRSF6 associated factor 1
    • UBX domain protein 3A
    • UBX domain-containing protein 12
    • UBX domain-containing protein 3A
    • UBXD12
    • UBXN3A
    see all
  • Function
    Potentiates but cannot initiate FAS-induced apoptosis.
  • Tissue specificity
    Most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon. Not detected in the peripheral blood leukocytes.
  • Sequence similarities
    Contains 1 UBX domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161305 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up