Recombinant Human FAM107A protein (ab161335)

Overview

  • Product name
    Recombinant Human FAM107A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRE LLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQEL LRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
    • Amino acids
      1 to 144
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Down regulated in renal cell carcinoma 1
    • Down-regulated in renal cell carcinoma 1
    • Downregulated in renal cell carcinoma
    • DRR1
    • F107A_HUMAN
    • FAM107A
    • Family with sequence similarity 107, member A
    • FLJ30158
    • FLJ45473
    • Protein FAM107A
    • Protein TU3A
    • TU3A
    see all
  • Function
    When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development.
  • Tissue specificity
    Widely expressed in normal tissues. Expression is reduced or absent in a number of cancer cell lines.
  • Sequence similarities
    Belongs to the FAM107 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161335 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up