Recombinant Human FAM126A protein (ab164633)

Overview

  • Product name
    Recombinant Human FAM126A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFTSEKGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQS ELLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSASRNVHSSGC IEALLLGVYNLEIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTES ALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSL QSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYN GEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLPHGPMKSNKEGTRC IQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEG FYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGES CKDHFARKQTQRAQSENLELLSLKRLTLTTSQSLPKPSSHGLAKTAATVF SKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTEL PMKHQSGQQRPPSISITLSTD
    • Amino acids
      1 to 521
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Down regulated by Ctnnb1 a
    • Down regulated by CTNNB1 protein A
    • Down-regulated by CTNNB1 protein A
    • DRCTNNB1A
    • FAM126A
    • Family with sequence similarity 126 member A
    • HCC
    • HLD5
    • HYCC1
    • HYCCI_HUMAN
    • Hyccin
    • Protein FAM126A
    see all
  • Function
    Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane (PubMed:26571211). The complex acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis (PubMed:26571211). FAM126A plays a key role in oligodendrocytes formation, a cell type with expanded plasma membrane that requires generation of PtdIns(4)P (PubMed:26571211). Its role in oligodendrocytes formation probably explains its importance in myelination of the central and peripheral nervous system (PubMed:26571211, PubMed:16951682). May also have a role in the beta-catenin/Lef signaling pathway.
  • Tissue specificity
    Widely expressed. Highest levels in heart, brain, placenta, spleen and testis.
  • Involvement in disease
    Leukodystrophy, hypomyelinating, 5
  • Sequence similarities
    Belongs to the FAM126 family.
  • Cellular localization
    Cytoplasm, cytosol. Cell membrane. Localizes to the cytosol and is recruited to the plasma membrane following interaction with other components of the phosphatidylinositol 4-kinase (PI4K) complex.
  • Information by UniProt

Images

  • ab164633 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up