Recombinant Human FAM129A protein (ab165110)

Overview

  • Product name
    Recombinant Human FAM129A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGSASSQLDEGKCAYIRGKTEAAIKNFSPYYSRQYSVAFCNHVRTEVEQ QRDLTSQFLKTKPPLAPGTILYEAELSQFSEDIKKWKERYVVVKNDYAVE SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE NTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLSDCVRHLNH DYMKQMTFEAQAFLEAVQFFRQEKGHYGSWEMITGDEIQILSNLVMEELL PTLQTDLLPKMKGKKNDRKRTWLGLLEEAYTLVQHQVSEGLSALKEECRA LTKGLEGTIRSDMDQIVNSKNYLIGKIKAMVAQPAEKSCLESVQPFLASI LEELMGPVSSGFSEVRVLFEKEVNEVSQNFQTTKDSVQLKEHLDRLMNLP LHSVKMEPCYTKVNLLHERLQDLKSRFRFPHIDLVVQRTQNYMQELMENA VFTFEQLLSPHLQGEASKTAVAIEKVKLRVLKQYDYDSSTIRKKIFQEAL VQITLPTVQKALASTCKPELQKYEQFIFADHTNMIHVENVYEEILHQILL DETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARR ASAILPGVLGSETLSNEVFQESEEEKQPEVPSSLAKGESLSLPGPSPPPD GTEQVIISRVDDPVVNPVATEDTAGLPGTCSSELEFGGTLEDEEPAQEEP EPITASGSLKALRKLLTASVEVPVDSAPVMEEDTNGESHVPQENEEEEEK EPSQAAAIHPDNCEESEVSEREAQPPCPEAHGEELGGFPEVGSPASPPAS GGLTEEPLGPMEGELPGEACTLTAHEGRGGKCTEEGDASQQEGCTLGSDP ICLSESQVSEEQEEMGGQSSAAQATASVNAEEIKVARIHECQWVVEDAPN PDVLLSHKDDVKEGEGGQESFPELPSEE
    • Amino acids
      1 to 928
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell growth inhibiting gene 39 protein
    • Cell growth-inhibiting gene 39 protein
    • FAM129A
    • NIBAN_HUMAN
    • Protein FAM129A
    • Protein Niban
    see all
  • Function
    Regulates phosphorylation of a number of proteins involved in translation regulation including EIF2A, EIF4EBP1 and RPS6KB1. May be involved in the endoplasmic reticulum stress response.
  • Tissue specificity
    Expressed in various types of thyroid tumor such as papillary thyroid carcinomas and oxyphilic thyroid tumors but not in normal thyroid tissue (at protein level). Strongly expressed in heart, skeletal muscle, pancreas, white blood cells and prostate with moderate expression in colon and spleen. Expressed in renal carcinoma cells but not in normal kidney.
  • Sequence similarities
    Belongs to the Niban family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab165110 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up