Recombinant Human FAM172A protein (ab194054)

Overview

  • Product name
    Recombinant Human FAM172A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFN EKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCN LKKVSIPVDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARR LIINEDLDSGTQIPFIKRAVAEGYGVIVLNPNENYIEVEKPKIHVQSSSD SSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPE EHAIYVWDHFIAQAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVA LTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVS AGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEELVD HHHHHH
    • Molecular weight
      47 kDa including tags
    • Amino acids
      19 to 416
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names
    • C5orf21
    • F172A_HUMAN
    • fam172a
    • Family with sequence similarity 172, member A
    • Protein FAM172A
    see all
  • Sequence similarities
    Belongs to the UPF0528 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab194054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up