Recombinant Human FAM190A protein (ab166496)

Overview

  • Product name
    Recombinant Human FAM190A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTN SSSGSTGKRRSIFRTPSISFHHKKGSEPKQEPTNQNLSISNGAQPGHSNM QKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKEHSTNKNVFIN CLSSGKSEGDDSGFTEDQTRRSVKQSTRKLLPKSFSSHYKFSKPVLQSQS ISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSAD LTTAQTPSEFLALTEDSVSEMDAFSKSGSMASHCDNFGHNDSTSQMSLNS AAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLL QIAELPATSVSHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQH KAIAEHVKGIHPISDSKIIPTSGDHHIFNKTSHGYEANPAKVLASSLSPF REGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKM NSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDSYHSVVSCAAV VLTPMEPMIEMKKREEPEFPEPSKQNLSLKLTKDVDQEARCSHISRMPNS PSADWPLQGVEENGGIDSLPFRLMLQDCTAVKTLLLKMKRVLQESADMSP ASSTTSLPVSPLTEEPVPFKTTYPREF
    • Amino acids
      1 to 677
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6230405M12Rik
    • C130092O11Rik
    • F190A_HUMAN
    • FAM190A
    • Family with sequence similarity 190, member A
    • Hypothetical protein LOC232035
    • KIAA1680
    • KIAA1680 protein
    • MGC130404
    • MGC130405
    • MGC48628
    • Protein FAM190A
    • RGD1565731
    see all
  • Sequence similarities
    Belongs to the FAM190 family.
  • Information by UniProt

Images

  • ab166496 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up