Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTA APRARKYKCGLPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLMSSVKDN VGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVAS YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQH VKNSKHSNKYEGWPEALEMEGCIPRRSTAS
    • Amino acids
      1 to 230
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-19
    • 2.19
    • Cytokine-like protein 2-19
    • DLD
    • DXS560S
    • FAM3A
    • FAM3A_HUMAN
    • family with sequence similarity 3, member A
    • Protein FAM3A
    • XAP 7
    see all
  • Function
    May act as a defensin against invading fungal microorganisms.
  • Tissue specificity
    In similar amounts in testis, pancreas, adrenal, placenta, brain, fetal brain, liver, kidney, skeletal muscle and heart.
  • Sequence similarities
    Belongs to the FAM3 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab163710 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up