Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMQVFEIKMDASLGNLFARSALDTAARSTKP PRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRG INVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDG ATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNN KDTNKYEGWPEVVEMEGCIPQKQD
    • Molecular weight
      25 kDa including tags
    • Amino acids
      25 to 227
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113122 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Fam3c
    • FAM3C_HUMAN
    • Family with sequence similarity 3 member C
    • GS3786
    • ILEI
    • Interleukin-like EMT inducer
    • Predicted osteoblast protein
    • Protein FAM3C
    see all
  • Function
    May be involved in retinal laminar formation. Promotes epithelial to mesenchymal transition.
  • Tissue specificity
    Present in most secretory epithelia (at protein level).
  • Sequence similarities
    Belongs to the FAM3 family.
  • Cellular localization
    Secreted. Cytoplasmic vesicle. Cytoplasmic in some cancer cells.
  • Information by UniProt

Recombinant Human FAM3C protein images

  • 15% SDS-PAGE analysis of ab113122 (3µg)

References for Recombinant Human FAM3C protein (ab113122)

ab113122 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up