Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMQVFEIKMDASLGNLFARSALDTAARSTKP PRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRG INVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDG ATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNN KDTNKYEGWPEVVEMEGCIPQKQD
    • Molecular weight
      25 kDa including tags
    • Amino acids
      25 to 227
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113122 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Fam3c
    • FAM3C_HUMAN
    • Family with sequence similarity 3 member C
    • GS3786
    • ILEI
    • Interleukin-like EMT inducer
    • Predicted osteoblast protein
    • Protein FAM3C
    see all
  • Function
    May be involved in retinal laminar formation. Promotes epithelial to mesenchymal transition.
  • Tissue specificity
    Present in most secretory epithelia (at protein level).
  • Sequence similarities
    Belongs to the FAM3 family.
  • Cellular localization
    Secreted. Cytoplasmic vesicle. Cytoplasmic in some cancer cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab113122 (3µg)

References

ab113122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up