Recombinant Human FAM65B protein (ab160640)

Overview

  • Product name
    Recombinant Human FAM65B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLVGSQSFSPGGPNGIIRSQSFAGFSGLQERRSRCNSFIENSSALKKPQA KLKKMHNLGHKNNNPPKEPQPKRVEEVYRALKNGLDEYLEVHQTELDKLT AQLKDMKRNSRLGVLYDLDKQIKTIERYMRRLEFHISKVDELYEAYCIQR RLQDGASKMKQAFATSPASKAARESLTEINRSFKEYTENMCTIEVELENL LGEFSIKMKGLAGFARLCPGDQYEIFMKYGRQRWKLKGKIEVNGKQSWDG EETVFLPLIVGFISIKVTELKGLATHILVGSVTCETKELFAARPQVVAVD INDLGTIKLNLEITWYPFDVEDMTASSGAGNKAAALQRRMSMYSQGTPET PTFKDHSFFSNLPDDIFENGKAAEEKMPLSLSFSDLPNGDCALTSHSTGS PSNSTNPEITITPAEFNLSSLASQNEGMDDTSSASSRNSLGEGQEPKSHL KEEDPEEPRKPASAPSEACRRQSSGAGAEHLFLENDVAEALLQESEEASE LKPVELDTSEGNITKQLVKRLTSAEVPMATDRLLSEGSVGGESEGCRSFL DGSLEDAFNGLLLALEPHKEQYKEFQDLNQEVMNLDDILKK
    • Amino acids
      1 to 591
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ab2 162
    • C6orf32
    • DIFF48
    • FA65B_HUMAN
    • Fam65b
    • KIAA0386
    • PL48
    • Protein FAM65B
    see all
  • Function
    Isoform 2 play a role in promoting myogenic cell differentiation, cytoskeletal rearrangement and filopodia formation.
  • Tissue specificity
    Isoform 1 is present in the brain. Isoform 2 is expressed during differentiation of fetal primary myoblasts. Also shows marked expression during cytotrophoblast differentiation.
  • Sequence similarities
    Belongs to the FAM65 family.
  • Post-translational
    modifications
    Asn-41 was reported (PubMed:16335952) to be N-glycosylated; however as this position is probably not extracellular, the in vivo relevance is not proven.
  • Cellular localization
    Mitochondrion and Cytoplasm > cytoskeleton. Cell projection > filopodium. Detected in cellular filopodia.
  • Information by UniProt

Images

  • ab160640 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up