Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYE ALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINK
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA80I15.1
    • FA 3
    • FA3
    • FAC
    • FACC
    • FANCC
    • FANCC_HUMAN
    • Fanconi anemia complementation group C
    • Fanconi anemia complementation group C protein
    • Fanconi anemia group C protein
    • Fanconi pancytopenia type 3
    • FLJ14675
    • Protein FACC
    see all
  • Function
    DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. Upon IFNG induction, may facilitate STAT1 activation by recruiting STAT1 to IFNGR1.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in FANCC are the cause of Fanconi anemia complementation group C (FANCC) [MIM:227645]. A disorder affecting all bone marrow elements and resulting in anemia, leukopenia and thrombopenia. It is associated with cardiac, renal and limb malformations, dermal pigmentary changes, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage) and defective DNA repair.
  • Developmental stage
    Expression increases during S phase, is maximal at the G2/M transition, and declines during M phase (at protein level).
  • Cellular localization
    Nucleus. Cytoplasm. The major form is nuclear. The minor form is cytoplasmic.
  • Information by UniProt

Images

  • ab158415 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up