Overview

  • Product name
    Recombinant Human FANCE protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATPDAGLPGAEGVEPAPWAQLEAPARLLLQALQAGPEGARRGLGVLRAL GSRGWEPFDWGRLLEALCREEPVVQGPDGRLELKPLLLRLPRICQRNLMS LLMAVRPSLPESGLLSVLQIAQQDLAPDPDAWLRALGELLRRDLGVGTSM EGASPLSERCQRQLQSLCRGLGLGGRRLKSPQAPDPEEEENRDSQQPGKR RKDSEEEAASPEGKRVPKRLRCWEEEEDHEKERPEHKSLESLADGGSASP IKDQPVMAVKTGEDGSNLDDAKGLAESLELPKAIQDQLPRLQQLLKTLEE GLEGLEDAPPVELQLLHECSPSQMDLLCAQLQLPQLSDLGLLRLCTWLLA LSPDLSLSNATVLTRSLFLGRILSLTSSASRLLTTALTSFCAKYTYPVCS ALLDPVLQAPGTGPAQTELLCCLVKMESLEPDAQVLMLGQILELPWKEET FLVLQSLLERQVEMTPEKFSVLMEKLCKKGLAATTSMAYAKLMLTVMTKY QANITETQRLGLAMALEPNTTFLRKSLKAALKHLGP
    • Amino acids
      1 to 536
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2810451D06Rik
    • AI415634
    • AW209126
    • FACE
    • FAE
    • FANCE
    • FANCE_HUMAN
    • Fanconi anemia complementation group E
    • Fanconi anemia group E protein
    • OTTHUMP00000016254
    • Protein FACE
    • RGD1561045
    see all
  • Function
    As part of the Fanconi anemia (FA) complex functions in DNA cross-links repair. Required for the nuclear accumulation of FANCC and provides a critical bridge between the FA complex and FANCD2.
  • Involvement in disease
    Fanconi anemia complementation group E
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation by CHEK1 at Thr-346 and Ser-374 regulates its function in DNA cross-links repair.
    Ubiquitinated. Phosphorylation by CHEK1 induces polyubiquitination and degradation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158416 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up