Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9NPI8
    • SpeciesHuman
    • SequenceMESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGR HGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDV
    • Molecular weight36 kDa including tags
    • Amino acids1 to 91

Specifications

Our Abpromise guarantee covers the use of ab116744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • A730016A17
    • FACF
    • FAF
    • FANCF
    • FANCF_HUMAN
    • Fanconi anemia complementation group F
    • Fanconi anemia group F protein
    • MGC126856
    • Protein FACF
    • RGD1561456
    see all
  • FunctionDNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability.
  • Involvement in diseaseDefects in FANCF are a cause of Fanconi anemia (FA) [MIM:227650]. FA is a genetically heterogeneous, autosomal recessive disorder characterized by progressive pancytopenia, a diverse assortment of congenital malformations, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage), and defective DNA repair.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human FANCF protein images

  • 12.5% SDS-PAGE of ab116744 at approximately 35.64kDa stained with Coomassie Blue.

References for Recombinant Human FANCF protein (ab116744)

ab116744 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"