Overview

  • Product name
    Recombinant Human FANCG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALE GLRGLLHSLQGLPAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQR SLERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALHRLVGLQAA LWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQ DAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQV YTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTA ELESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKH ILASRCLQTGRAGDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFL EAAVALIQAGRAQDALTLCEELLSRTSSLLPKMSRLWEDARKGTKELPYC PLWVSATHLLQGQAWVQLGAQKVAISEFSRCLELLFRATPEEKEQGAAFN CEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLSVQMCPGNR DTYFHLLQTLKRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLS WIRPSDRDAFLEEFRTSLPKSCDL
    • Molecular weight
      95 kDa including tags
    • Amino acids
      1 to 622

Specifications

Our Abpromise guarantee covers the use of ab114925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DNA repair protein XRCC9
    • FAG
    • FANCG
    • FANCG_HUMAN
    • Fanconi anaemia complementation group G
    • Fanconi anemia group G protein
    • Protein FACG
    • X ray repair, complementing defective, in Chinese hamster cells 9
    • X-ray repair, complementing defective, in Chinese hamster, 9
    • XRCC9
    see all
  • Function
    DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. Candidate tumor suppressor gene.
  • Tissue specificity
    Highly expressed in testis and thymus. Found in lymphoblasts.
  • Involvement in disease
    Defects in FANCG are a cause of Fanconi anemia (FA) [MIM:227650]. FA is a genetically heterogeneous, autosomal recessive disorder characterized by progressive pancytopenia, a diverse assortment of congenital malformations, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage), and defective DNA repair.
  • Sequence similarities
    Contains 4 TPR repeats.
  • Cellular localization
    Nucleus. Cytoplasm. The major form is nuclear. The minor form is cytoplasmic.
  • Information by UniProt

Recombinant Human FANCG protein images

  • 12.5% SDS-PAGE showing ab114925 at approximately 94.53kDa.
    Stained with Coomassie Blue.

References for Recombinant Human FANCG protein (ab114925)

ab114925 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up