Overview

  • Product name
    Recombinant Human FARS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPAAECATQRAPGSVVELLGKSYPQDDHSN LTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDN LSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLH AGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGESL QLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVD CYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLG LERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVIN DISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYR ITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF
    • Molecular weight
      51 kDa including tags
    • Amino acids
      37 to 451
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • dJ236A3.1 (phenylalanine tRNA synthetase)
    • dJ520B18.2 (FARS1 (phenylalanine tRNA synthetase))
    • FARS1
    • Fars2
    • HSPC320
    • Phenylalanine translase
    • Phenylalanine tRNA ligase
    • Phenylalanine tRNA ligase 2, mitochondrial
    • Phenylalanine tRNA synthetase 1 (mitochondrial)
    • Phenylalanine tRNA synthetase 2 (mitochondrial)
    • Phenylalanine--tRNA ligase
    • Phenylalanyl tRNA synthetase 2
    • Phenylalanyl-tRNA synthetase, mitochondrial
    • PheRS
    • SYFM_HUMAN
    see all
  • Function
    Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family.
    Contains 1 FDX-ACB domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant Human FARS2 protein images

  • 15% SDS PAGE analysis of ab105613 (3 µg)

References for Recombinant Human FARS2 protein (ab105613)

ab105613 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up