Recombinant human Fas Ligand protein (Active) (ab109359)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.050 Eu/µg
- Active: Yes
- Tags: DDDDK tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human Fas Ligand protein (Active)
See all Fas Ligand proteins and peptides -
Biological activity
Induces apoptosis of human Jurkat T cells at a concentration of <1ng/ml in the presence of 0.1 to 1μg/ml TNF Ligands Enhancer. In the absence of TNF Ligands Enhancer, ab109359 is working at 50-100 fold higher concentrations.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.050 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGK SNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSC NNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLT SADHLYVNVSELSLVNFEESQTFFGLYKL -
Predicted molecular weight
33 kDa including tags -
Amino acids
103 to 281 -
Tags
DDDDK tag N-Terminus -
Additional sequence information
Extracellular domain.
-
Associated products
-
Related Products
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
- Anti-Fas Ligand antibody (ab134401)
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [F-tag-01] (ab18230)
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab21536)
- HRP Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [M2] (ab49763)
Specifications
Our Abpromise guarantee covers the use of ab109359 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100µl sterile water. PBS containing at least 0.1% BSA should be used for further dilutions.
General Info
-
Alternative names
- ALPS1B
- Apoptosis (APO 1) antigen ligand 1
- Apoptosis antigen ligand
see all -
Function
Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects. -
Involvement in disease
Defects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Post-translational
modificationsN-glycosylated.
The soluble form derives from the membrane form by proteolytic processing. -
Cellular localization
Cell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab109359 has been referenced in 1 publication.
- Thiyagarajan D et al. IL-1ß Promotes a New Function of DNase I as a Transcription Factor for the Fas Receptor Gene. Front Cell Dev Biol 6:7 (2018). PubMed: 29468159