Recombinant Human Fas Ligand protein (ab109359)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGK SNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSC NNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLT SADHLYVNVSELSLVNFEESQTFFGLYKL
    • Molecular weight
      33 kDa including tags
    • Amino acids
      103 to 281
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Induces apoptosis of Jurkat T cells at a concentration of <1ng/ml in the presence of 0.1 to 1µg/ml TNF Ligand enhancer. In the absence of TNF Ligand enhancer ab109359 is working at 50-100 fold higher concentrations.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    ab109359 can bind to human and mouse Fas.
  • Form
    Lyophilised
  • Additional notes
    Induces apoptosis of Jurkat T cells at a concentration of <1ng/ml in the presence of 0.1 to 1µg/ml TNF Ligand enhancer. In the absence of TNF Ligand enhancer ab109359 is working at 50-100 fold higher concentrations.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS

  • Reconstitution
    Reconstitute with 100µl sterile water. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names
    • ALPS1B
    • Apoptosis (APO 1) antigen ligand 1
    • Apoptosis antigen ligand
    • Apoptosis antigen ligand 1
    • APT1LG1
    • APTL
    • CD178
    • CD178 antigen
    • CD95 ligand
    • CD95-L
    • CD95L
    • CD95L protein
    • Fas antigen ligand
    • Fas L
    • Fas ligand
    • Fas ligand (TNF superfamily member 6)
    • FASL
    • Fasl Fas ligand (TNF superfamily member 6)
    • FASLG
    • Generalized lymphoproliferative disease
    • Gld
    • soluble form
    • TNFL6_HUMAN
    • TNFSF6
    • Tumor necrosis factor (ligand) superfamily member 6
    • Tumor necrosis factor ligand superfamily member 6
    see all
  • Function
    Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
  • Involvement in disease
    Defects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications
    N-glycosylated.
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization
    Cell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface.
  • Information by UniProt

References

ab109359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up