Recombinant Human Fas Ligand protein (ab109359)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP48023
    • SpeciesHuman
    • SequenceQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGK SNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSC NNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLT SADHLYVNVSELSLVNFEESQTFFGLYKL
    • Molecular weight33 kDa including tags
    • Amino acids103 to 281
    • TagsDDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityInduces apoptosis of Jurkat T cells at a concentration of <1ng/ml in the presence of 0.1 to 1µg/ml TNF Ligand enhancer. In the absence of TNF Ligand enhancer ab109359 is working at 50-100 fold higher concentrations.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 95 % SDS-PAGE.
    ab109359 can bind to human and mouse Fas.
  • FormLyophilised
  • Additional notes Induces apoptosis of Jurkat T cells at a concentration of <1ng/ml in the presence of 0.1 to 1µg/ml TNF Ligand enhancer. In the absence of TNF Ligand enhancer ab109359 is working at 50-100 fold higher concentrations.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS

  • ReconstitutionReconstitute with 100µl sterile water. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names
    • ALPS1B
    • Apoptosis (APO 1) antigen ligand 1
    • Apoptosis antigen ligand
    • Apoptosis antigen ligand 1
    • APT1LG1
    • APTL
    • CD178
    • CD178 antigen
    • CD95 ligand
    • CD95-L
    • CD95L
    • CD95L protein
    • Fas antigen ligand
    • Fas L
    • Fas ligand
    • Fas ligand (TNF superfamily member 6)
    • FASL
    • Fasl Fas ligand (TNF superfamily member 6)
    • FASLG
    • Generalized lymphoproliferative disease
    • Gld
    • soluble form
    • TNFL6_HUMAN
    • TNFSF6
    • Tumor necrosis factor (ligand) superfamily member 6
    • Tumor necrosis factor ligand superfamily member 6
    see all
  • FunctionCytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
  • Involvement in diseaseDefects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similaritiesBelongs to the tumor necrosis factor family.
  • Post-translational
    modifications
    N-glycosylated.
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localizationCell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface.
  • Information by UniProt

References for Recombinant Human Fas Ligand protein (ab109359)

ab109359 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"