Recombinant human Fas Ligand protein (ab157085)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKG GLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKM MSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLY KL
    • Molecular weight
      32 kDa including tags
    • Amino acids
      103 to 281
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ED50: 50ng/ml (A20 cells). Kills Jurkat cells at concentrations of >10ng/ml in the absence of a cross-linker. Cross-linking enhancer increases the activity of rhsFasL approx. 50-fold. Please note: Results using sFasL may differ from those obtained with agonistic antibodies.
  • Applications

    Western blot

    ELISA

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    > 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab157085 is purified by Multi-Step Chromatography.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum.

General Info

  • Alternative names
    • ALPS1B
    • Apoptosis (APO 1) antigen ligand 1
    • Apoptosis antigen ligand
    • Apoptosis antigen ligand 1
    • APT1LG1
    • APTL
    • CD178
    • CD178 antigen
    • CD95 ligand
    • CD95-L
    • CD95L
    • CD95L protein
    • Fas antigen ligand
    • Fas L
    • Fas ligand
    • Fas ligand (TNF superfamily member 6)
    • FASL
    • Fasl Fas ligand (TNF superfamily member 6)
    • FASLG
    • Generalized lymphoproliferative disease
    • Gld
    • soluble form
    • TNFL6_HUMAN
    • TNFSF6
    • Tumor necrosis factor (ligand) superfamily member 6
    • Tumor necrosis factor ligand superfamily member 6
    see all
  • Function
    Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
  • Involvement in disease
    Defects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications
    N-glycosylated.
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization
    Cell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface.
  • Information by UniProt

Images

  • Activity Assay analysis: Inhibition of ab157085-mediated lysis. Fas (human):Fc (Human) (rec.) exerts its inhibitory activity in a concentration range of 0.5-5µg/ml in the presence of the enhancer (1µg/ml).

References

ab157085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up