Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTV NGDEPDCVPC QEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQ NTKCRCKPNFFCNSTVCEHCDP CTKCEHGIIKECTLTSNTKCKEEGSR SN
    • Molecular weight
      18 kDa
    • Amino acids
      26 to 173
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Bioactivity: Measured by ab155701 ability to inhibit Fas Ligand-induced apoptosis of Jurkat Human acute T cell leukemia cells.

    The ED50 for this effect is typically 3-20 pg/ml in the presence of 2 ng/ml recombinant Human Fas Ligand.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    Lyophilized from 0.22 µm filtered solution
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 99% PBS
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • ALPS 1A
    • ALPS1A
    • APO 1
    • Apo 1 antigen
    • APO 1 cell surface antigen
    • Apo-1 antigen
    • APO1
    • Apo1 antigen
    • APO1 cell surface antigen
    • Apoptosis antigen 1
    • Apoptosis mediating surface antigen FAS
    • Apoptosis-mediating surface antigen FAS
    • APT 1
    • APT1
    • CD 95
    • CD 95 antigen
    • CD95
    • CD95 antigen
    • Delta Fas
    • Delta Fas/APO 1/CD95
    • Delta Fas/APO1/CD95
    • Fas
    • Fas (TNF receptor superfamily, member 6)
    • FAS 1
    • FAS 827dupA
    • Fas AMA
    • FAS Antigen
    • Fas cell surface death receptor
    • FAS1
    • FASLG receptor
    • FASTM
    • sFAS
    • Surface antigen APO1
    • TNF receptor superfamily, member 6
    • TNFRSF 6
    • TNFRSF6
    • TNR6_HUMAN
    • Tumor necrosis factor receptor superfamily member 6
    see all
  • Function
    Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
  • Tissue specificity
    Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6.
  • Involvement in disease
    Defects in FAS are the cause of autoimmune lymphoproliferative syndrome type 1A (ALPS1A) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities
    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Domain
    Contains a death domain involved in the binding of FADD, and maybe to other cytosolic adapter proteins.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab155701 stained overnight with Coomassie Blue.

References

ab155701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up