Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRRPRGEPGPRAPRPTEGATCAGPGESWSPSPNSMLRVLLSAQTSPARLS GLLLIPPVQPCCLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLR WLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQDLSQLIIRNC PSFDIHTIHVCLHLAVLLGFPSDGPLVCALEQERRLRLPPKPPPPLQPLL RGGQGLEAALSCPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARH RLREPQLLEAIAHFLVVQETQLSSKVVQKLVLPFGRLNYLPLEQQFMPCL ERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPH ALIVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYS HKDIVAEGLRQLLGEEKYRQDLTVPPGYCTDFLLCASSSGAVLPVRTQDP FLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRAL RERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG
    • Amino acids
      1 to 549
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fas activated serine threonine kinase
    • Fas-activated serine/threonine kinase
    • FAST
    • FAST kinase
    • FASTK
    • FASTK_HUMAN
    • FLJ13079
    see all
  • Function
    Phosphorylates the splicing regulator TIA1, thereby promoting the inclusion of FAS exon 6, which leads to an mRNA encoding a pro-apoptotic form of the receptor.
  • Tissue specificity
    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the FAST protein kinase family.
    Contains 1 RAP domain.
  • Post-translational
    modifications
    Autophosphorylated on serine/threonine residues. Activated by dephosphorylation.
  • Information by UniProt

Images

  • ab161201 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up