Overview

  • Product name
    Recombinant Human FATP3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GMAALVLRPPHALDLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQ KVRMANEGFDPSTLSDPLYVLDQAVGAYLPLTTARYSALLAGNLRI
    • Amino acids
      635 to 730
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACSVL3
    • FATP 3
    • FATP-3
    • FATP3
    • Fatty acid transport protein 3
    • Long chain fatty acid transport protein 3
    • Long-chain fatty acid transport protein 3
    • mFLJ00207 protein
    • MGC4365
    • OTTHUMP00000035252
    • OTTHUMP00000038688
    • PSEC0067
    • S27A3_HUMAN
    • Slc27a3
    • Solute carrier family 27 (fatty acid transporter), member 3
    • Solute carrier family 27 member 3
    • Very long chain acyl CoA synthetase homolog 3
    • Very long-chain acyl-CoA synthetase homolog 3
    • VLCS 3
    • VLCS-3
    see all
  • Function
    Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. Does not exhibit fatty acid transport activity.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab161234 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161234 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up