Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP35544
    • SpeciesHuman
    • SequenceMQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLED EATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKK KKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
    • Molecular weight40 kDa including tags
    • Amino acids1 to 133

Specifications

Our Abpromise guarantee covers the use of ab114756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40S ribosomal protein S30
    • asr1
    • FAU
    • FAU encoded ubiquitin like protein
    • FAU1
    • FBR MuSV associated ubiquitously expressed
    • Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed
    • Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed (fox derived)
    • Finkel Biskis Reilly murine sarcoma virus ubiquitously expressed
    • FLJ22986
    • Fub1
    • Fubi
    • MNSFbeta
    • Monoclonal nonspecific suppressor factor beta
    • Ribosomal protein S30
    • RPS30
    • S30
    • UBIM_HUMAN
    • Ubiquitin like protein fubi
    • Ubiquitin like protein fubi and ribosomal protein S30
    • Ubiquitin like S30 fusion protein
    • Ubiquitin-like protein FUBI
    see all
  • Sequence similaritiesBelongs to the ubiquitin family.
  • Information by UniProt

Recombinant Human FAU protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114756 at approximately 40.37kDa.

References for Recombinant Human FAU protein (ab114756)

ab114756 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"