Recombinant Human FBLIM1 protein (ab156959)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMASKPEKRVASSVFITLAPPRRDVAVA EEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAP MQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGA SLIADLEQLHLSPPPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKG ASTDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKD GRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIG DESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRN FHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 373
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab156959 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • 2410043F08Rik
    • Cal
    • CSX associated LIM
    • DKFZp434G171
    • FBLI1_HUMAN
    • FBLIM 1
    • Fblim1
    • FBLP 1
    • FBLP-1
    • FBLP1
    • Filamin binding LIM protein 1
    • Filamin-binding LIM protein 1
    • Gt10
    • MGC105665
    • MIG2 interacting protein;
    • MIG2-interacting protein
    • Migfilin
    • Mitogen inducible 2 interacting protein
    • Mitogen-inducible 2-interacting protein
    • OTTHUMP00000003118
    • OTTHUMP00000003119
    • OTTHUMP00000003120
    • OTTMUSP00000011062
    • OTTMUSP00000011063
    • RP11-169K16.5
    • RP23-291H3.1
    see all
  • Function
    Serves as an anchoring site for cell-ECM adhesion proteins and filamin-containing actin filaments. Is implicated in cell shape modulation (spreading) and motility. May participate in the regulation of filamin-mediated cross-linking and stabilization of actin filaments. May also regulate the assembly of filamin-containing signaling complexes that control actin assembly.
  • Tissue specificity
    Isoform 1 and isoform 3 are expressed in heart, kidney, lung, pancreas, placenta and platelets. Isoform 2 is expressed in brain, heart, kidney, lung, pancreas, placenta, skeletal muscle and platelets.
  • Sequence similarities
    Contains 3 LIM zinc-binding domains.
  • Cellular localization
    Cytoplasm > cell cortex. Cell junction > focal adhesion. Cytoplasm > cytoskeleton. Associated with actin stress fiber at cell-ECM focal adhesion sites. Isoform 1 and isoform 3 are recruited and localized at actin stress fibers and clustered at cell-EMC adhesion sites through interaction with PLEKHC1. Isoform 2 is localized at actin stress fibers.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156959 (3 µg).

References

ab156959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up