Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINM WVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRD LVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKK MYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLS PQDFINLFKF
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 210

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4833442G10Rik
    • AI430017
    • Atrogin 1
    • Atrogin-1
    • ATROGIN1
    • Atrophy gene 1
    • F box only protein 32
    • F-box only protein 32
    • F-box protein 32
    • FBX32_HUMAN
    • fbxo25
    • FBXO32
    • FLJ32424
    • MAFbx
    • MGC108443
    • MGC137646
    • MGC33610
    • Muscle atrophy F box
    • Muscle atrophy F box protein
    • Muscle atrophy F-box protein
    see all
  • Function
    Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
  • Tissue specificity
    Specifically expressed in cardiac and skeletal muscle.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 F-box domain.
  • Information by UniProt

Images

  • ab112429 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up