Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ969P5
    • SpeciesHuman
    • SequenceMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINM WVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRD LVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKK MYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLS PQDFINLFKF
    • Molecular weight49 kDa including tags
    • Amino acids1 to 210

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4833442G10Rik
    • AI430017
    • Atrogin 1
    • Atrogin-1
    • ATROGIN1
    • Atrophy gene 1
    • F box only protein 32
    • F-box only protein 32
    • F-box protein 32
    • FBX32_HUMAN
    • fbxo25
    • FBXO32
    • FLJ32424
    • MAFbx
    • MGC108443
    • MGC137646
    • MGC33610
    • Muscle atrophy F box
    • Muscle atrophy F box protein
    • Muscle atrophy F-box protein
    see all
  • FunctionSubstrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
  • Tissue specificitySpecifically expressed in cardiac and skeletal muscle.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 F-box domain.
  • Information by UniProt

Recombinant Human Fbx32 protein images

  • ab112429 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Fbx32 protein (ab112429)

ab112429 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"