Recombinant Human FBXL16 protein (ab165534)

Overview

  • Product name
    Recombinant Human FBXL16 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPP PPPTLPPPSLAAPLSRAALAGGPCTPAGGPASALAPGHPAERPPLATDEK ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVL PGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSL KRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVS DCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLR LLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRS LDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLR SLYLRWCCQVQDFGLKHLLALGSLRLLSPAGCPLLTTTGLSGLVQLQELE ELELTNCPGATPELFKYFSQHLPRCLVIE
    • Amino acids
      1 to 479
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC042620
    • C16orf22
    • c380A1.1
    • c380A1.1 (novel protein)
    • Chromosome 16 open reading frame 22
    • F box and leucine rich repeat protein 16
    • F box/LRR repeat protein 16
    • F-box and leucine-rich repeat protein 16
    • F-box/LRR-repeat protein 16
    • Fbl16
    • FBXL 16
    • Fbxl16
    • Fbxl16 F-box and leucine-rich repeat protein 16
    • FLJ33735
    • FXL16_HUMAN
    • MGC33974
    • OTTHUMP00000115487
    • Scirr1
    • Spinal cord injury and regeneration-related protein 1
    see all
  • Function
    Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt

Images

  • ab165534 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up