Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKY LPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F box and leucine rich repeat protein 3
    • F box and leucine rich repeat protein 3A
    • F box protein Fbl3a
    • F-box and leucine-rich repeat protein 3A
    • F-box/LRR-repeat protein 3
    • F-box/LRR-repeat protein 3A
    • FBL3
    • FBL3A
    • Fbxl3
    • FBXL3_HUMAN
    • FBXL3A
    see all
  • Function
    Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex involved in circadian clock function. The SCF(FBXL3) complex acts by mediating ubiquitination and subsequent degradation of CRY1 and CRY2. Recruiter of target protein that may recognize and bind to some phosphorylated proteins and promotes their ubiquitination and degradation.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 7 LRR (leucine-rich) repeats.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear.
  • Information by UniProt

Images

  • ab161930 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up