Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDEL PEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPE GGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEE LPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPA IVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGW MEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
    • Amino acids
      1 to 296
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F box gene 1
    • F box only protein 2
    • F box protein 2
    • F box protein only 2
    • F-box only protein 2
    • FBG 1
    • FBG1
    • Fbs 1
    • Fbs1
    • Fbs2
    • FBX 2
    • FBX2
    • FBX2_HUMAN
    • FBXO 2
    • FBXO2
    • Neural F box protein NFB42
    • Neural F-box protein, 42-KD, rat, homolog of
    • NFB 42
    • NFB42
    • OCP1
    • organ of Corti protein 1
    • Prpl4
    see all
  • Function
    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 FBA (F-box associated) domain.
  • Cellular localization
    Cytoplasm. Microsome membrane.
  • Information by UniProt

Images

  • ab161936 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up