Recombinant Human FBXO40 protein (ab162649)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGKARRSPPGHHRHCEGCFNRHCHIPVEPNTSCLVISCHLLCGATFHMCK EAEHQLLCPLEQVPCLNSEYGCPLSMSRHKLAKHLQVCPASVVCCSMEWN RWPNVDSETTLHENIMKETPSEECLDTALALQDQKVLFRSLKMVELFPET REATEEEPTMNGETSVEEMGGAVGGVDIGLVPHGLSATNGEMAELSQEER EVLAKTKEGMDLVKFGQWENIFSKEHAASALTNSSASCESKNKNDSEKEQ ISSGHNMVEGEGAPKKKEPQENQKQQDVRTAMETTGLAPWQDGVLERLKT AVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGKLEAQEVKTVYTF KVPVSYCGKRARLGDAMLSCKPSEHKAVDTSDLGITVEDLPKSDLIKTTL QCALERELKGHVISESRSIDGLFMDFATQTYNFEPEQFSSGTVLADLTAA TPGGLHVELHSECVTRRHNKSSSAFTFTCNKFFRRDEFPLHFKNVHTDIQ SCLNGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQELKTFAIKPEVA PELSEGRKNNHLLGHGGKSQNSLTSLPLEILKYIAGFLDSVSLAQLSQVS VLMRNICATLLQERGMVLLQWKKKRYSHGGTSWRVHREIWQFSSLFSKIK SWEFNEVTSMSEHLKSCPFNIVEHKTDPILLTSMCQPREQARESLVSTFR IRPRGRYVS
    • Amino acids
      1 to 709
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F box only protein 40
    • F box protein 40
    • F-box only protein 40
    • FBX40
    • FBX40_HUMAN
    • Fbxo40
    • KIAA1195
    • Muscle disease related protein
    • Muscle disease-related protein
    see all
  • Function
    Probable substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex that may function in myogenesis.
  • Tissue specificity
    Expressed only in heart and skeletal muscle.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 TRAF-type zinc finger.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162649 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up