Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSS SNLENRPCRAARGSLQKTSADTKGKQEQAKEEKARELFLKAVEEEQNGAL YEAIKFYRRAMQLVPDIEFKITYTRSPDGDGVGNSYIEDNDDDSKMADLL SYFQQQLTFQESVLKLCQPELESSQIHISVLPMEVLMYIFRWVVSSDLDL RSLEQLSLVCRGFYICARDPEIWRLACLKVWGRSCIKLVPYTSWREMFLE RPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYIRFFPDGHVMM LTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTKVFAVITKKKE EKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHIT YKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL
    • Amino acids
      1 to 437
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cross-immune reaction antigen 1
    • dJ341E18.2
    • DKFZp434C0118
    • F-box only protein 9
    • Fbp24
    • FBX09
    • FBX9
    • FBX9_HUMAN
    • Fbxo9
    • KIAA0936
    • NY REN 57
    • OTTHUMP00000016628
    • OTTHUMP00000016629
    • OTTHUMP00000214588
    • Renal carcinoma antigen NY-REN-57
    • VCIA1
    see all
  • Function
    Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 TPR repeat.
  • Information by UniProt

Images

  • ab161954 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up