Recombinant Human Fc epsilon RI protein (ab114334)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLT CNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNE SEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHP KPNPKNN
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 257

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fc epsilon RI alpha
    • Fc epsilon RI alpha chain
    • Fc epsilon RI alpha-chain
    • Fc fragment of IgE high affinity I receptor for alpha polypeptide
    • Fc fragment of IgE, high affinity I, receptor for, alpha subunit
    • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
    • Fc IgE receptor alpha polypeptide
    • Fc IgE receptor, alpha chain
    • Fc IgE receptor, alpha polypeptide
    • Fc of IgE high affinity I receptor for alpha polypeptide
    • Fc-epsilon RI-alpha
    • FCE 1A
    • FCE1A
    • FCER 1A
    • Fcer1a
    • FCERA_HUMAN
    • FcERI
    • FceRI alpha
    • high affinity IgE receptor
    • High affinity immunoglobulin epsilon receptor alpha subunit
    • high affinity immunoglobulin epsilon receptor alpha-subunit
    • High affinity immunoglobulin epsilon receptor subunit alpha
    • IgE Fc receptor alpha subunit
    • IgE Fc receptor subunit alpha
    • Immunoglobulin E receptor high affinity of mast cells alpha polypeptide
    • immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
    see all
  • Function
    Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
  • Sequence similarities
    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Fc epsilon RI protein images

  • ab114334 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Fc epsilon RI protein (ab114334)

ab114334 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up