Recombinant Human Fc epsilon RI protein (ab114334)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLT CNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNE SEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHP KPNPKNN
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 257

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fc epsilon RI alpha
    • Fc epsilon RI alpha chain
    • Fc epsilon RI alpha-chain
    • Fc fragment of IgE high affinity I receptor for alpha polypeptide
    • Fc fragment of IgE, high affinity I, receptor for, alpha subunit
    • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
    • Fc IgE receptor alpha polypeptide
    • Fc IgE receptor, alpha chain
    • Fc IgE receptor, alpha polypeptide
    • Fc of IgE high affinity I receptor for alpha polypeptide
    • Fc-epsilon RI-alpha
    • FCE 1A
    • FCE1A
    • FCER 1A
    • Fcer1a
    • FCERA_HUMAN
    • FcERI
    • FceRI alpha
    • high affinity IgE receptor
    • High affinity immunoglobulin epsilon receptor alpha subunit
    • high affinity immunoglobulin epsilon receptor alpha-subunit
    • High affinity immunoglobulin epsilon receptor subunit alpha
    • IgE Fc receptor alpha subunit
    • IgE Fc receptor subunit alpha
    • Immunoglobulin E receptor high affinity of mast cells alpha polypeptide
    • immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
    see all
  • Function
    Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
  • Sequence similarities
    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114334 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up