Recombinant Human FCGR1A protein (ab114415)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQT STPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      16 to 115

Specifications

Our Abpromise guarantee covers the use of ab114415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD64
    • CD64A
    • Fc fragment of IgG high affinity Ia receptor (CD64)
    • Fc fragment of IgG, high affinity Ia, receptor for
    • Fc gamma receptor
    • Fc gamma receptor I A1
    • Fc gamma RI
    • Fc gamma RIA
    • Fc-gamma RI
    • Fc-gamma RIA
    • FCG1
    • FcgammaRIa
    • FCGR1
    • FCGR1_HUMAN
    • FCGR1A
    • FcRI
    • FLJ18345
    • High affinity immunoglobulin gamma Fc receptor I
    • IGFR1
    • IgG Fc receptor I
    • Immunoglobulin G Fc receptor I
    • OTTHUMP00000013913
    see all
  • Function
    High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
  • Tissue specificity
    Monocyte/macrophage specific.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. FCGR1 family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Phosphorylated on serine residues.
  • Cellular localization
    Cell membrane. Stabilized at the cell membrane through interaction with FCER1G.
  • Information by UniProt

Recombinant Human FCGR1A protein images

  • 12.5% SDS-PAGE analysis of FCGR1A protein (ab114415). Stained with Coomassie Blue.

References for Recombinant Human FCGR1A protein (ab114415)

ab114415 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up