Recombinant Human FCGR1A protein (ab114416)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP12314
    • SpeciesHuman
    • SequenceMWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPG SSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEI HRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWN SNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTS PLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTA RREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEE LKCQEQKEEQLQEGVHRKEPQGAT
    • Molecular weight67 kDa including tags
    • Amino acids1 to 374

Specifications

Our Abpromise guarantee covers the use of ab114416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD64
    • CD64A
    • Fc fragment of IgG high affinity Ia receptor (CD64)
    • Fc fragment of IgG, high affinity Ia, receptor for
    • Fc gamma receptor
    • Fc gamma receptor I A1
    • Fc gamma RI
    • Fc gamma RIA
    • Fc-gamma RI
    • Fc-gamma RIA
    • FCG1
    • FcgammaRIa
    • FCGR1
    • FCGR1_HUMAN
    • FCGR1A
    • FcRI
    • FLJ18345
    • High affinity immunoglobulin gamma Fc receptor I
    • IGFR1
    • IgG Fc receptor I
    • Immunoglobulin G Fc receptor I
    • OTTHUMP00000013913
    see all
  • FunctionHigh affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
  • Tissue specificityMonocyte/macrophage specific.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. FCGR1 family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Phosphorylated on serine residues.
  • Cellular localizationCell membrane. Stabilized at the cell membrane through interaction with FCER1G.
  • Information by UniProt

Recombinant Human FCGR1A protein images

  • ab114416 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human FCGR1A protein (ab114416)

ab114416 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"