Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE AFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTW GGDWPEALAI
    • Molecular weight
      38 kDa including tags
    • Amino acids
      51 to 160

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha chain
    • Fc fragment of IgG, receptor transporter, alpha
    • FCGRN_HUMAN
    • FCGRT
    • FcRn
    • FcRn alpha chain
    • FCRN, alpha chain
    • IgG Fc fragment receptor transporter alpha chain
    • IgG Gc receptor
    • IgG receptor FcRn large subunit p51
    • IgG receptor FcRn large subunit p51 precursor
    • Immunoglobulin receptor, intestinal, heavy chain
    • Neonatal Fc receptor
    see all
  • Function
    Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152382 stained with Coomassie Blue.

References

ab152382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up