Overview

  • Product name
    Recombinant Human FCN3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAP GSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCL PEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEF WLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLAL GKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRS NLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
    • Amino acids
      1 to 288
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collagen/fibrinogen domain containing lectin 3 p35
    • Collagen/fibrinogen domain containing protein 3
    • FCN 3
    • FCNH
    • Ficolin (collagen/fibrinogen domain containing) 3
    • Ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
    • Ficolin 3
    • H ficolin
    • HAKA1
    • Hakata antigen
    • MGC22543
    see all
  • Relevance
    FCN3 (Ficolin 3) is involved in the serum exerting lectin activity. In human serum, there are two types of ficolins, both of which have lectin activity. FCN3 is a thermolabile beta 2 macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. It can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway.
  • Cellular localization
    Secreted. Note: Found in blood plasma, bronchus, alveolus and bile duct.

Images

  • ab160086 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Zhao C  et al. Early second-trimester plasma protein profiling using multiplexed isobaric tandem mass tag (TMT) labeling predicts gestational diabetes mellitus. Acta Diabetol 52:1103-12 (2015). WB ; Human . Read more (PubMed: 26259496) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up