Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP37268
    • SpeciesHuman
    • SequenceMEFVKCLGHPEEFYNLVRFRVGGKRKVMPKMDQDSLSSSLKTCYKYLNQT SRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNF HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM GIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGED TERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPE NIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL AACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP DSDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQY LTTLSQVTEDYVQTGEH
    • Molecular weight72 kDa including tags
    • Amino acids1 to 417

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DGPT
    • ERG9
    • Farnesyl diphosphate farnesyltransferase
    • Farnesyl-diphosphate farnesyltransferase
    • FDFT_HUMAN
    • FDFT1
    • FPP:FPP farnesyltransferase
    • SQS
    • Squalene synthase
    • Squalene synthetase
    • SS
    see all
  • PathwayTerpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 1/3.
  • Sequence similaritiesBelongs to the phytoene/squalene synthase family.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human FDFT1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114930

References for Recombinant Human FDFT1 protein (ab114930)

ab114930 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"